Description
Product Description
Protein Description: ubiquilin 4
Gene Name: UBQLN4
Alternative Gene Name: A1U, C1orf6, UBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008604: 100%, ENSRNOG00000019933: 100%
Entrez Gene ID: 56893
Uniprot ID: Q9NRR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBQLN4
Alternative Gene Name: A1U, C1orf6, UBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008604: 100%, ENSRNOG00000019933: 100%
Entrez Gene ID: 56893
Uniprot ID: Q9NRR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN |
Gene Sequence | EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN |
Gene ID - Mouse | ENSMUSG00000008604 |
Gene ID - Rat | ENSRNOG00000019933 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti UBQLN4 pAb (ATL-HPA061797) | |
Datasheet | Anti UBQLN4 pAb (ATL-HPA061797) Datasheet (External Link) |
Vendor Page | Anti UBQLN4 pAb (ATL-HPA061797) at Atlas Antibodies |
Documents & Links for Anti UBQLN4 pAb (ATL-HPA061797) | |
Datasheet | Anti UBQLN4 pAb (ATL-HPA061797) Datasheet (External Link) |
Vendor Page | Anti UBQLN4 pAb (ATL-HPA061797) |