Anti UBQLN3 pAb (ATL-HPA062018 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062018-25

• 

Product Description

Protein Description: ubiquilin 3
Gene Name: UBQLN3
Alternative Gene Name: TUP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051618: 58%, ENSRNOG00000023833: 56%
Entrez Gene ID: 50613
Uniprot ID: Q9H347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANRVPFAPLSFSPTAAIPGIPEPPWLPSPAYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIE
• Gene Sequence: ANRVPFAPLSFSPTAAIPGIPEPPWLPSPAYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIE
• Gene ID - Mouse: ENSMUSG00000051618
• Gene ID - Rat: ENSRNOG00000023833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.