Protein Description: ubiquitination factor E4A
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 98%, ENSRNOG00000026833: 97%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 98%, ENSRNOG00000026833: 97%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF |
| Documents & Links for Anti UBE4A pAb (ATL-HPA064010) | |
| Datasheet | Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link) |
| Vendor Page | Anti UBE4A pAb (ATL-HPA064010) at Atlas |
| Documents & Links for Anti UBE4A pAb (ATL-HPA064010) | |
| Datasheet | Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link) |
| Vendor Page | Anti UBE4A pAb (ATL-HPA064010) |