Description
Product Description
Protein Description: ubiquitination factor E4A
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 98%, ENSRNOG00000026833: 97%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 98%, ENSRNOG00000026833: 97%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF |
Gene Sequence | SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF |
Gene ID - Mouse | ENSMUSG00000059890 |
Gene ID - Rat | ENSRNOG00000026833 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti UBE4A pAb (ATL-HPA064010) | |
Datasheet | Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link) |
Vendor Page | Anti UBE4A pAb (ATL-HPA064010) at Atlas Antibodies |
Documents & Links for Anti UBE4A pAb (ATL-HPA064010) | |
Datasheet | Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link) |
Vendor Page | Anti UBE4A pAb (ATL-HPA064010) |