Description
Product Description
Protein Description: ubiquitin-conjugating enzyme E2S
Gene Name: UBE2S
Alternative Gene Name: E2-EPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060860: 100%, ENSRNOG00000016930: 100%
Entrez Gene ID: 27338
Uniprot ID: Q16763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBE2S
Alternative Gene Name: E2-EPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060860: 100%, ENSRNOG00000016930: 100%
Entrez Gene ID: 27338
Uniprot ID: Q16763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
| Gene Sequence | MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
| Gene ID - Mouse | ENSMUSG00000060860 |
| Gene ID - Rat | ENSRNOG00000016930 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti UBE2S pAb (ATL-HPA057150) | |
| Datasheet | Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link) |
| Vendor Page | Anti UBE2S pAb (ATL-HPA057150) at Atlas Antibodies |
| Documents & Links for Anti UBE2S pAb (ATL-HPA057150) | |
| Datasheet | Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link) |
| Vendor Page | Anti UBE2S pAb (ATL-HPA057150) |