Anti UBE2M pAb (ATL-HPA057800 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA057800-100

• 
• 
• 

Product Description

Protein Description: ubiquitin-conjugating enzyme E2M
Gene Name: UBE2M
Alternative Gene Name: hUbc12, UBC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005575: 100%, ENSRNOG00000027514: 100%
Entrez Gene ID: 9040
Uniprot ID: P61081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQ
• Gene Sequence: KLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQ
• Gene ID - Mouse: ENSMUSG00000005575
• Gene ID - Rat: ENSRNOG00000027514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.