Anti U2AF1L4 pAb (ATL-HPA061644)

Atlas Antibodies

Catalog No: ATL-HPA061644-25

• 

Product Description

Protein Description: U2 small nuclear RNA auxiliary factor 1-like 4
Gene Name: U2AF1L4
Alternative Gene Name: MGC33901, U2AF1L3, U2af26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 33%, ENSRNOG00000060753: 32%
Entrez Gene ID: 199746
Uniprot ID: Q8WU68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
• Gene Sequence: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
• Gene ID - Mouse: ENSMUSG00000025366
• Gene ID - Rat: ENSRNOG00000060753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.