Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)

Catalog No:
ATL-HPA074922-25
$328.00

Description

Product Description

Protein Description: thymidylate synthetase
Gene Name: TYMS
Alternative Gene Name: HsT422, TMS, TS, Tsase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025747: 92%, ENSRNOG00000037225: 90%
Entrez Gene ID: 7298
Uniprot ID: P04818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
Gene Sequence SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
Gene ID - Mouse ENSMUSG00000025747
Gene ID - Rat ENSRNOG00000037225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)
Datasheet Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)
Datasheet Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)

Product Description

Protein Description: thymidylate synthetase
Gene Name: TYMS
Alternative Gene Name: HsT422, TMS, TS, Tsase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025747: 92%, ENSRNOG00000037225: 90%
Entrez Gene ID: 7298
Uniprot ID: P04818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
Gene Sequence SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
Gene ID - Mouse ENSMUSG00000025747
Gene ID - Rat ENSRNOG00000037225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)
Datasheet Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)
Datasheet Anti TYMS pAb (ATL-HPA074922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TYMS pAb (ATL-HPA074922 w/enhanced validation)