Description
Product Description
Protein Description: thioredoxin reductase 3 neighbor
Gene Name: TXNRD3NB
Alternative Gene Name: TR2IT1, TXNRD3IT1, TXNRD3NT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040690: 30%, ENSRNOG00000031475: 30%
Entrez Gene ID:
Uniprot ID: Q6F5E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TXNRD3NB
Alternative Gene Name: TR2IT1, TXNRD3IT1, TXNRD3NT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040690: 30%, ENSRNOG00000031475: 30%
Entrez Gene ID:
Uniprot ID: Q6F5E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP |
Gene Sequence | SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP |
Gene ID - Mouse | ENSMUSG00000040690 |
Gene ID - Rat | ENSRNOG00000031475 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TXNRD3NB pAb (ATL-HPA058257) | |
Datasheet | Anti TXNRD3NB pAb (ATL-HPA058257) Datasheet (External Link) |
Vendor Page | Anti TXNRD3NB pAb (ATL-HPA058257) at Atlas Antibodies |
Documents & Links for Anti TXNRD3NB pAb (ATL-HPA058257) | |
Datasheet | Anti TXNRD3NB pAb (ATL-HPA058257) Datasheet (External Link) |
Vendor Page | Anti TXNRD3NB pAb (ATL-HPA058257) |