Anti TXNL4B pAb (ATL-HPA065865)

Atlas Antibodies

Catalog No: ATL-HPA065865-25

• 

Product Description

Protein Description: thioredoxin-like 4B
Gene Name: TXNL4B
Alternative Gene Name: Dim2, DLP, FLJ20511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031723: 96%, ENSRNOG00000021379: 96%
Entrez Gene ID: 54957
Uniprot ID: Q9NX01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQ
• Gene Sequence: SFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQ
• Gene ID - Mouse: ENSMUSG00000031723
• Gene ID - Rat: ENSRNOG00000021379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.