Protein Description: thioredoxin-like 4B
Gene Name: TXNL4B
Alternative Gene Name: Dim2, DLP, FLJ20511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031723: 96%, ENSRNOG00000021379: 96%
Entrez Gene ID: 54957
Uniprot ID: Q9NX01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TXNL4B
Alternative Gene Name: Dim2, DLP, FLJ20511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031723: 96%, ENSRNOG00000021379: 96%
Entrez Gene ID: 54957
Uniprot ID: Q9NX01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQ |
Documents & Links for Anti TXNL4B pAb (ATL-HPA065865) | |
Datasheet | Anti TXNL4B pAb (ATL-HPA065865) Datasheet (External Link) |
Vendor Page | Anti TXNL4B pAb (ATL-HPA065865) at Atlas |
Documents & Links for Anti TXNL4B pAb (ATL-HPA065865) | |
Datasheet | Anti TXNL4B pAb (ATL-HPA065865) Datasheet (External Link) |
Vendor Page | Anti TXNL4B pAb (ATL-HPA065865) |