Protein Description: taxilin alpha
Gene Name: TXLNA
Alternative Gene Name: DKFZp451J0118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053841: 86%, ENSRNOG00000048242: 88%
Entrez Gene ID: 200081
Uniprot ID: P40222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TXLNA
Alternative Gene Name: DKFZp451J0118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053841: 86%, ENSRNOG00000048242: 88%
Entrez Gene ID: 200081
Uniprot ID: P40222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVV |
| Documents & Links for Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) | |
| Datasheet | Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) at Atlas |
| Documents & Links for Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) | |
| Datasheet | Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TXLNA pAb (ATL-HPA072477 w/enhanced validation) |