Anti TWIST2 pAb (ATL-HPA062870)

Atlas Antibodies

Catalog No: ATL-HPA062870-25

• 

Product Description

Protein Description: twist family bHLH transcription factor 2
Gene Name: TWIST2
Alternative Gene Name: bHLHa39, Dermo-1, DERMO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007805: 100%, ENSRNOG00000020355: 100%
Entrez Gene ID: 117581
Uniprot ID: Q8WVJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL
• Gene Sequence: ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL
• Gene ID - Mouse: ENSMUSG00000007805
• Gene ID - Rat: ENSRNOG00000020355
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.