Protein Description: twist family bHLH transcription factor 2
Gene Name: TWIST2
Alternative Gene Name: bHLHa39, Dermo-1, DERMO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007805: 100%, ENSRNOG00000020355: 100%
Entrez Gene ID: 117581
Uniprot ID: Q8WVJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TWIST2
Alternative Gene Name: bHLHa39, Dermo-1, DERMO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007805: 100%, ENSRNOG00000020355: 100%
Entrez Gene ID: 117581
Uniprot ID: Q8WVJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL |
| Documents & Links for Anti TWIST2 pAb (ATL-HPA062870) | |
| Datasheet | Anti TWIST2 pAb (ATL-HPA062870) Datasheet (External Link) |
| Vendor Page | Anti TWIST2 pAb (ATL-HPA062870) at Atlas |
| Documents & Links for Anti TWIST2 pAb (ATL-HPA062870) | |
| Datasheet | Anti TWIST2 pAb (ATL-HPA062870) Datasheet (External Link) |
| Vendor Page | Anti TWIST2 pAb (ATL-HPA062870) |