Anti TUT1 pAb (ATL-HPA071838)

Atlas Antibodies

Catalog No: ATL-HPA071838-25

• 

Product Description

Protein Description: terminal uridylyl transferase 1, U6 snRNA-specific
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 81%, ENSRNOG00000020047: 80%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
• Gene Sequence: LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
• Gene ID - Mouse: ENSMUSG00000071645
• Gene ID - Rat: ENSRNOG00000020047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.