Description
Product Description
Protein Description: terminal uridylyl transferase 1, U6 snRNA-specific
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 81%, ENSRNOG00000020047: 80%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 81%, ENSRNOG00000020047: 80%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD |
Gene Sequence | LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD |
Gene ID - Mouse | ENSMUSG00000071645 |
Gene ID - Rat | ENSRNOG00000020047 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TUT1 pAb (ATL-HPA071838) | |
Datasheet | Anti TUT1 pAb (ATL-HPA071838) Datasheet (External Link) |
Vendor Page | Anti TUT1 pAb (ATL-HPA071838) at Atlas Antibodies |
Documents & Links for Anti TUT1 pAb (ATL-HPA071838) | |
Datasheet | Anti TUT1 pAb (ATL-HPA071838) Datasheet (External Link) |
Vendor Page | Anti TUT1 pAb (ATL-HPA071838) |