Protein Description: tocopherol (alpha) transfer protein-like
Gene Name: TTPAL
Alternative Gene Name: C20orf121, dJ179M20.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017679: 99%, ENSRNOG00000009076: 96%
Entrez Gene ID: 79183
Uniprot ID: Q9BTX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTPAL
Alternative Gene Name: C20orf121, dJ179M20.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017679: 99%, ENSRNOG00000009076: 96%
Entrez Gene ID: 79183
Uniprot ID: Q9BTX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLH |
Documents & Links for Anti TTPAL pAb (ATL-HPA066532) | |
Datasheet | Anti TTPAL pAb (ATL-HPA066532) Datasheet (External Link) |
Vendor Page | Anti TTPAL pAb (ATL-HPA066532) at Atlas |
Documents & Links for Anti TTPAL pAb (ATL-HPA066532) | |
Datasheet | Anti TTPAL pAb (ATL-HPA066532) Datasheet (External Link) |
Vendor Page | Anti TTPAL pAb (ATL-HPA066532) |