Protein Description: titin
Gene Name: TTN
Alternative Gene Name: CMD1G, CMH9, CMPD4, FLJ32040, LGMD2J, MYLK5, TMD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051747: 96%, ENSRNOG00000021410: 30%
Entrez Gene ID: 7273
Uniprot ID: Q8WZ42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTN
Alternative Gene Name: CMD1G, CMH9, CMPD4, FLJ32040, LGMD2J, MYLK5, TMD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051747: 96%, ENSRNOG00000021410: 30%
Entrez Gene ID: 7273
Uniprot ID: Q8WZ42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMK |
| Documents & Links for Anti TTN pAb (ATL-HPA030048 w/enhanced validation) | |
| Datasheet | Anti TTN pAb (ATL-HPA030048 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TTN pAb (ATL-HPA030048 w/enhanced validation) at Atlas |
| Documents & Links for Anti TTN pAb (ATL-HPA030048 w/enhanced validation) | |
| Datasheet | Anti TTN pAb (ATL-HPA030048 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TTN pAb (ATL-HPA030048 w/enhanced validation) |