Protein Description: TELO2 interacting protein 1
Gene Name: TTI1
Alternative Gene Name: KIAA0406, smg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027650: 85%, ENSRNOG00000012880: 83%
Entrez Gene ID: 9675
Uniprot ID: O43156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTI1
Alternative Gene Name: KIAA0406, smg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027650: 85%, ENSRNOG00000012880: 83%
Entrez Gene ID: 9675
Uniprot ID: O43156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTT |
Documents & Links for Anti TTI1 pAb (ATL-HPA068338) | |
Datasheet | Anti TTI1 pAb (ATL-HPA068338) Datasheet (External Link) |
Vendor Page | Anti TTI1 pAb (ATL-HPA068338) at Atlas |
Documents & Links for Anti TTI1 pAb (ATL-HPA068338) | |
Datasheet | Anti TTI1 pAb (ATL-HPA068338) Datasheet (External Link) |
Vendor Page | Anti TTI1 pAb (ATL-HPA068338) |