Anti TTI1 pAb (ATL-HPA068338)

Atlas Antibodies

Catalog No: ATL-HPA068338-25

• 

Product Description

Protein Description: TELO2 interacting protein 1
Gene Name: TTI1
Alternative Gene Name: KIAA0406, smg-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027650: 85%, ENSRNOG00000012880: 83%
Entrez Gene ID: 9675
Uniprot ID: O43156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTT
• Gene Sequence: ERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTT
• Gene ID - Mouse: ENSMUSG00000027650
• Gene ID - Rat: ENSRNOG00000012880
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.