Anti TTC7B pAb (ATL-HPA059577 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA059577-25

• 
• 
• 

Product Description

Protein Description: tetratricopeptide repeat domain 7B
Gene Name: TTC7B
Alternative Gene Name: TTC7L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033530: 99%, ENSRNOG00000027300: 98%
Entrez Gene ID: 145567
Uniprot ID: Q86TV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSD
• Gene Sequence: HYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSD
• Gene ID - Mouse: ENSMUSG00000033530
• Gene ID - Rat: ENSRNOG00000027300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.