Description
Product Description
Protein Description: tetratricopeptide repeat domain 6
Gene Name: TTC6
Alternative Gene Name: C14orf25, NCRNA00291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046782: 70%, ENSRNOG00000016105: 30%
Entrez Gene ID: 319089
Uniprot ID: Q86TZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTC6
Alternative Gene Name: C14orf25, NCRNA00291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046782: 70%, ENSRNOG00000016105: 30%
Entrez Gene ID: 319089
Uniprot ID: Q86TZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL |
Gene Sequence | NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL |
Gene ID - Mouse | ENSMUSG00000046782 |
Gene ID - Rat | ENSRNOG00000016105 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TTC6 pAb (ATL-HPA069293) | |
Datasheet | Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link) |
Vendor Page | Anti TTC6 pAb (ATL-HPA069293) at Atlas Antibodies |
Documents & Links for Anti TTC6 pAb (ATL-HPA069293) | |
Datasheet | Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link) |
Vendor Page | Anti TTC6 pAb (ATL-HPA069293) |