Protein Description: tetratricopeptide repeat domain 39C
Gene Name: TTC39C
Alternative Gene Name: C18orf17, FLJ33761, HsT2697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024424: 98%, ENSRNOG00000050949: 96%
Entrez Gene ID: 125488
Uniprot ID: Q8N584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTC39C
Alternative Gene Name: C18orf17, FLJ33761, HsT2697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024424: 98%, ENSRNOG00000050949: 96%
Entrez Gene ID: 125488
Uniprot ID: Q8N584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ |
| Documents & Links for Anti TTC39C pAb (ATL-HPA065705) | |
| Datasheet | Anti TTC39C pAb (ATL-HPA065705) Datasheet (External Link) |
| Vendor Page | Anti TTC39C pAb (ATL-HPA065705) at Atlas |
| Documents & Links for Anti TTC39C pAb (ATL-HPA065705) | |
| Datasheet | Anti TTC39C pAb (ATL-HPA065705) Datasheet (External Link) |
| Vendor Page | Anti TTC39C pAb (ATL-HPA065705) |