Protein Description: tetratricopeptide repeat domain 39B
Gene Name: TTC39B
Alternative Gene Name: C9orf52, FLJ33868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038172: 92%, ENSRNOG00000042603: 91%
Entrez Gene ID: 158219
Uniprot ID: Q5VTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTC39B
Alternative Gene Name: C9orf52, FLJ33868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038172: 92%, ENSRNOG00000042603: 91%
Entrez Gene ID: 158219
Uniprot ID: Q5VTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQ |
| Documents & Links for Anti TTC39B pAb (ATL-HPA063162) | |
| Datasheet | Anti TTC39B pAb (ATL-HPA063162) Datasheet (External Link) |
| Vendor Page | Anti TTC39B pAb (ATL-HPA063162) at Atlas |
| Documents & Links for Anti TTC39B pAb (ATL-HPA063162) | |
| Datasheet | Anti TTC39B pAb (ATL-HPA063162) Datasheet (External Link) |
| Vendor Page | Anti TTC39B pAb (ATL-HPA063162) |