Description
Product Description
Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF |
Gene Sequence | LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF |
Gene ID - Mouse | ENSMUSG00000034848 |
Gene ID - Rat | ENSRNOG00000034089 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TTC21B pAb (ATL-HPA073293) | |
Datasheet | Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link) |
Vendor Page | Anti TTC21B pAb (ATL-HPA073293) at Atlas Antibodies |
Documents & Links for Anti TTC21B pAb (ATL-HPA073293) | |
Datasheet | Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link) |
Vendor Page | Anti TTC21B pAb (ATL-HPA073293) |