![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101094/181142/atl-hpa073293_anti-ttc21b-pab-atl-hpa073293_62810__72393.1681137401.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF |
| Documents & Links for Anti TTC21B pAb (ATL-HPA073293) | |
| Datasheet | Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link) |
| Vendor Page | Anti TTC21B pAb (ATL-HPA073293) at Atlas |
| Documents & Links for Anti TTC21B pAb (ATL-HPA073293) | |
| Datasheet | Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link) |
| Vendor Page | Anti TTC21B pAb (ATL-HPA073293) |