Description
Product Description
Protein Description: thiosulfate sulfurtransferase (rhodanese)-like domain containing 2
Gene Name: TSTD2
Alternative Gene Name: C9orf97, PP4189
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035495: 85%, ENSRNOG00000009724: 82%
Entrez Gene ID: 158427
Uniprot ID: Q5T7W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSTD2
Alternative Gene Name: C9orf97, PP4189
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035495: 85%, ENSRNOG00000009724: 82%
Entrez Gene ID: 158427
Uniprot ID: Q5T7W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EFPDGFYKGKLFVFDERYALSYNSDVVSECSYCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECECTARRPRIPRELLQHV |
Gene Sequence | EFPDGFYKGKLFVFDERYALSYNSDVVSECSYCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECECTARRPRIPRELLQHV |
Gene ID - Mouse | ENSMUSG00000035495 |
Gene ID - Rat | ENSRNOG00000009724 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TSTD2 pAb (ATL-HPA064304) | |
Datasheet | Anti TSTD2 pAb (ATL-HPA064304) Datasheet (External Link) |
Vendor Page | Anti TSTD2 pAb (ATL-HPA064304) at Atlas Antibodies |
Documents & Links for Anti TSTD2 pAb (ATL-HPA064304) | |
Datasheet | Anti TSTD2 pAb (ATL-HPA064304) Datasheet (External Link) |
Vendor Page | Anti TSTD2 pAb (ATL-HPA064304) |