Protein Description: testis specific serine kinase 4
Gene Name: TSSK4
Alternative Gene Name: C14orf20, STK22E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007591: 88%, ENSRNOG00000019789: 90%
Entrez Gene ID: 283629
Uniprot ID: Q6SA08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSSK4
Alternative Gene Name: C14orf20, STK22E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007591: 88%, ENSRNOG00000019789: 90%
Entrez Gene ID: 283629
Uniprot ID: Q6SA08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWS |
| Documents & Links for Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) | |
| Datasheet | Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) at Atlas |
| Documents & Links for Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) | |
| Datasheet | Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TSSK4 pAb (ATL-HPA077103 w/enhanced validation) |