Protein Description: testis specific protein, Y-linked 1
Gene Name: TSPY1
Alternative Gene Name: CT78, TSPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 38%, ENSRNOG00000023781: 38%
Entrez Gene ID: 7258
Uniprot ID: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSPY1
Alternative Gene Name: CT78, TSPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 38%, ENSRNOG00000023781: 38%
Entrez Gene ID: 7258
Uniprot ID: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE |
Documents & Links for Anti TSPY1 pAb (ATL-HPA067289) | |
Datasheet | Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link) |
Vendor Page | Anti TSPY1 pAb (ATL-HPA067289) at Atlas |
Documents & Links for Anti TSPY1 pAb (ATL-HPA067289) | |
Datasheet | Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link) |
Vendor Page | Anti TSPY1 pAb (ATL-HPA067289) |