Description
Product Description
Protein Description: tetraspanin 16
Gene Name: TSPAN16
Alternative Gene Name: TM-8, TM4-B, TM4SF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 31%, ENSRNOG00000051061: 33%
Entrez Gene ID: 26526
Uniprot ID: Q9UKR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSPAN16
Alternative Gene Name: TM-8, TM4-B, TM4SF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 31%, ENSRNOG00000051061: 33%
Entrez Gene ID: 26526
Uniprot ID: Q9UKR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS |
Gene Sequence | HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS |
Gene ID - Mouse | ENSMUSG00000007827 |
Gene ID - Rat | ENSRNOG00000051061 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) | |
Datasheet | Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) | |
Datasheet | Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) |