Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation)

Catalog No:
ATL-HPA076551-25
$447.00

Description

Product Description

Protein Description: tetraspanin 16
Gene Name: TSPAN16
Alternative Gene Name: TM-8, TM4-B, TM4SF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 31%, ENSRNOG00000051061: 33%
Entrez Gene ID: 26526
Uniprot ID: Q9UKR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
Gene Sequence HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
Gene ID - Mouse ENSMUSG00000007827
Gene ID - Rat ENSRNOG00000051061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation)
Datasheet Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation)

Product Description

Protein Description: tetraspanin 16
Gene Name: TSPAN16
Alternative Gene Name: TM-8, TM4-B, TM4SF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 31%, ENSRNOG00000051061: 33%
Entrez Gene ID: 26526
Uniprot ID: Q9UKR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
Gene Sequence HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
Gene ID - Mouse ENSMUSG00000007827
Gene ID - Rat ENSRNOG00000051061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation)
Datasheet Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TSPAN16 pAb (ATL-HPA076551 w/enhanced validation)