Anti TSPAN15 pAb (ATL-HPA071160)

Atlas Antibodies

Catalog No: ATL-HPA071160-100

• 
• 

Product Description

Protein Description: tetraspanin 15
Gene Name: TSPAN15
Alternative Gene Name: NET-7, TM4SF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037031: 81%, ENSRNOG00000046204: 84%
Entrez Gene ID: 23555
Uniprot ID: O95858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN
• Gene Sequence: RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN
• Gene ID - Mouse: ENSMUSG00000037031
• Gene ID - Rat: ENSRNOG00000046204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.