![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100723/180679/atl-hpa071160_anti-tspan15-pab-atl-hpa071160_62347__13149.1681136826.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: tetraspanin 15
Gene Name: TSPAN15
Alternative Gene Name: NET-7, TM4SF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037031: 81%, ENSRNOG00000046204: 84%
Entrez Gene ID: 23555
Uniprot ID: O95858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSPAN15
Alternative Gene Name: NET-7, TM4SF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037031: 81%, ENSRNOG00000046204: 84%
Entrez Gene ID: 23555
Uniprot ID: O95858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN |
| Documents & Links for Anti TSPAN15 pAb (ATL-HPA071160) | |
| Datasheet | Anti TSPAN15 pAb (ATL-HPA071160) Datasheet (External Link) |
| Vendor Page | Anti TSPAN15 pAb (ATL-HPA071160) at Atlas |
| Documents & Links for Anti TSPAN15 pAb (ATL-HPA071160) | |
| Datasheet | Anti TSPAN15 pAb (ATL-HPA071160) Datasheet (External Link) |
| Vendor Page | Anti TSPAN15 pAb (ATL-HPA071160) |