Protein Description: t-SNARE domain containing 1
Gene Name: TSNARE1
Alternative Gene Name: FLJ31164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111375: 27%, ENSRNOG00000056529: 29%
Entrez Gene ID: 203062
Uniprot ID: Q96NA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSNARE1
Alternative Gene Name: FLJ31164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111375: 27%, ENSRNOG00000056529: 29%
Entrez Gene ID: 203062
Uniprot ID: Q96NA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKT |
Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249) | |
Datasheet | Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link) |
Vendor Page | Anti TSNARE1 pAb (ATL-HPA074249) at Atlas |
Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249) | |
Datasheet | Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link) |
Vendor Page | Anti TSNARE1 pAb (ATL-HPA074249) |