Anti TSNARE1 pAb (ATL-HPA074249)

Catalog No:
ATL-HPA074249-25
$447.00

Description

Product Description

Protein Description: t-SNARE domain containing 1
Gene Name: TSNARE1
Alternative Gene Name: FLJ31164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111375: 27%, ENSRNOG00000056529: 29%
Entrez Gene ID: 203062
Uniprot ID: Q96NA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKT
Gene Sequence LALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKT
Gene ID - Mouse ENSMUSG00000111375
Gene ID - Rat ENSRNOG00000056529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249)
Datasheet Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link)
Vendor Page Anti TSNARE1 pAb (ATL-HPA074249) at Atlas Antibodies

Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249)
Datasheet Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link)
Vendor Page Anti TSNARE1 pAb (ATL-HPA074249)

Product Description

Protein Description: t-SNARE domain containing 1
Gene Name: TSNARE1
Alternative Gene Name: FLJ31164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111375: 27%, ENSRNOG00000056529: 29%
Entrez Gene ID: 203062
Uniprot ID: Q96NA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKT
Gene Sequence LALTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKT
Gene ID - Mouse ENSMUSG00000111375
Gene ID - Rat ENSRNOG00000056529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249)
Datasheet Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link)
Vendor Page Anti TSNARE1 pAb (ATL-HPA074249) at Atlas Antibodies

Documents & Links for Anti TSNARE1 pAb (ATL-HPA074249)
Datasheet Anti TSNARE1 pAb (ATL-HPA074249) Datasheet (External Link)
Vendor Page Anti TSNARE1 pAb (ATL-HPA074249)