Anti TSHZ2 pAb (ATL-HPA038123)

Catalog No:
ATL-HPA038123-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: teashirt zinc finger homeobox 2
Gene Name: TSHZ2
Alternative Gene Name: C20orf17, OVC10-2, TSH2, ZABC2, ZNF218
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047907: 89%, ENSRNOG00000048433: 90%
Entrez Gene ID: 128553
Uniprot ID: Q9NRE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSK

Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123)
Datasheet Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link)
Vendor Page Anti TSHZ2 pAb (ATL-HPA038123) at Atlas

Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123)
Datasheet Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link)
Vendor Page Anti TSHZ2 pAb (ATL-HPA038123)