Protein Description: teashirt zinc finger homeobox 2
Gene Name: TSHZ2
Alternative Gene Name: C20orf17, OVC10-2, TSH2, ZABC2, ZNF218
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047907: 89%, ENSRNOG00000048433: 90%
Entrez Gene ID: 128553
Uniprot ID: Q9NRE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSHZ2
Alternative Gene Name: C20orf17, OVC10-2, TSH2, ZABC2, ZNF218
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047907: 89%, ENSRNOG00000048433: 90%
Entrez Gene ID: 128553
Uniprot ID: Q9NRE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSK |
Gene ID - Mouse | ENSMUSG00000047907 |
Gene ID - Rat | ENSMUSG00000047907 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123) | |
Datasheet | Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link) |
Vendor Page | Anti TSHZ2 pAb (ATL-HPA038123) at Atlas Antibodies |
Documents & Links for Anti TSHZ2 pAb (ATL-HPA038123) | |
Datasheet | Anti TSHZ2 pAb (ATL-HPA038123) Datasheet (External Link) |
Vendor Page | Anti TSHZ2 pAb (ATL-HPA038123) |