Anti TSC22D1 pAb (ATL-HPA077414)

Catalog No:
ATL-HPA077414-25
$447.00
Protein Description: TSC22 domain family, member 1
Gene Name: TSC22D1
Alternative Gene Name: MGC17597, TGFB1I4, TSC22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022010: 74%, ENSRNOG00000001030: 78%
Entrez Gene ID: 8848
Uniprot ID: Q15714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
Gene ID - Mouse ENSMUSG00000022010
Gene ID - Rat ENSMUSG00000022010
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti TSC22D1 pAb (ATL-HPA077414)
Datasheet Anti TSC22D1 pAb (ATL-HPA077414) Datasheet (External Link)
Vendor Page Anti TSC22D1 pAb (ATL-HPA077414) at Atlas

Documents & Links for Anti TSC22D1 pAb (ATL-HPA077414)
Datasheet Anti TSC22D1 pAb (ATL-HPA077414) Datasheet (External Link)
Vendor Page Anti TSC22D1 pAb (ATL-HPA077414)