Anti TSC1 pAb (ATL-HPA074132)

Atlas Antibodies

Catalog No: ATL-HPA074132-25

• 

Product Description

Protein Description: tuberous sclerosis 1
Gene Name: TSC1
Alternative Gene Name: hamartin, KIAA0243, LAM, TSC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026812: 77%, ENSRNOG00000011470: 73%
Entrez Gene ID: 7248
Uniprot ID: Q92574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDYVHISLPQATVTPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEITT
• Gene Sequence: DDYVHISLPQATVTPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEITT
• Gene ID - Mouse: ENSMUSG00000026812
• Gene ID - Rat: ENSRNOG00000011470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.