Protein Description: tuberous sclerosis 1
Gene Name: TSC1
Alternative Gene Name: hamartin, KIAA0243, LAM, TSC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026812: 77%, ENSRNOG00000011470: 73%
Entrez Gene ID: 7248
Uniprot ID: Q92574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TSC1
Alternative Gene Name: hamartin, KIAA0243, LAM, TSC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026812: 77%, ENSRNOG00000011470: 73%
Entrez Gene ID: 7248
Uniprot ID: Q92574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DDYVHISLPQATVTPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEITT |
| Documents & Links for Anti TSC1 pAb (ATL-HPA074132) | |
| Datasheet | Anti TSC1 pAb (ATL-HPA074132) Datasheet (External Link) |
| Vendor Page | Anti TSC1 pAb (ATL-HPA074132) at Atlas |
| Documents & Links for Anti TSC1 pAb (ATL-HPA074132) | |
| Datasheet | Anti TSC1 pAb (ATL-HPA074132) Datasheet (External Link) |
| Vendor Page | Anti TSC1 pAb (ATL-HPA074132) |