Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)

Catalog No:
ATL-HPA071767-25
$395.00

Description

Product Description

Protein Description: transcriptional repressor GATA binding 1
Gene Name: TRPS1
Alternative Gene Name: GC79, LGCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038679: 95%, ENSRNOG00000024998: 98%
Entrez Gene ID: 7227
Uniprot ID: Q9UHF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM
Gene Sequence IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM
Gene ID - Mouse ENSMUSG00000038679
Gene ID - Rat ENSRNOG00000024998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)
Datasheet Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)
Datasheet Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)

Product Description

Protein Description: transcriptional repressor GATA binding 1
Gene Name: TRPS1
Alternative Gene Name: GC79, LGCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038679: 95%, ENSRNOG00000024998: 98%
Entrez Gene ID: 7227
Uniprot ID: Q9UHF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM
Gene Sequence IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM
Gene ID - Mouse ENSMUSG00000038679
Gene ID - Rat ENSRNOG00000024998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)
Datasheet Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)
Datasheet Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation)