Protein Description: transcriptional repressor GATA binding 1
Gene Name: TRPS1
Alternative Gene Name: GC79, LGCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038679: 95%, ENSRNOG00000024998: 98%
Entrez Gene ID: 7227
Uniprot ID: Q9UHF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRPS1
Alternative Gene Name: GC79, LGCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038679: 95%, ENSRNOG00000024998: 98%
Entrez Gene ID: 7227
Uniprot ID: Q9UHF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM |
| Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) | |
| Datasheet | Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) at Atlas |
| Documents & Links for Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) | |
| Datasheet | Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRPS1 pAb (ATL-HPA071767 w/enhanced validation) |