Description
Product Description
Protein Description: transient receptor potential cation channel subfamily M member 1
Gene Name: TRPM1
Alternative Gene Name: CSNB1C, LTRPC1, MLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030523: 41%, ENSRNOG00000015829: 42%
Entrez Gene ID: 4308
Uniprot ID: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRPM1
Alternative Gene Name: CSNB1C, LTRPC1, MLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030523: 41%, ENSRNOG00000015829: 42%
Entrez Gene ID: 4308
Uniprot ID: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR |
Gene Sequence | NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR |
Gene ID - Mouse | ENSMUSG00000030523 |
Gene ID - Rat | ENSRNOG00000015829 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TRPM1 pAb (ATL-HPA071139) | |
Datasheet | Anti TRPM1 pAb (ATL-HPA071139) Datasheet (External Link) |
Vendor Page | Anti TRPM1 pAb (ATL-HPA071139) at Atlas Antibodies |
Documents & Links for Anti TRPM1 pAb (ATL-HPA071139) | |
Datasheet | Anti TRPM1 pAb (ATL-HPA071139) Datasheet (External Link) |
Vendor Page | Anti TRPM1 pAb (ATL-HPA071139) |