Protein Description: transient receptor potential cation channel, subfamily C, member 4 associated protein
Gene Name: TRPC4AP
Alternative Gene Name: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038324: 100%, ENSRNOG00000019152: 100%
Entrez Gene ID: 26133
Uniprot ID: Q8TEL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRPC4AP
Alternative Gene Name: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038324: 100%, ENSRNOG00000019152: 100%
Entrez Gene ID: 26133
Uniprot ID: Q8TEL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS |
Documents & Links for Anti TRPC4AP pAb (ATL-HPA065061) | |
Datasheet | Anti TRPC4AP pAb (ATL-HPA065061) Datasheet (External Link) |
Vendor Page | Anti TRPC4AP pAb (ATL-HPA065061) at Atlas |
Documents & Links for Anti TRPC4AP pAb (ATL-HPA065061) | |
Datasheet | Anti TRPC4AP pAb (ATL-HPA065061) Datasheet (External Link) |
Vendor Page | Anti TRPC4AP pAb (ATL-HPA065061) |