Anti TRMT10A pAb (ATL-HPA058241)

Atlas Antibodies

Catalog No: ATL-HPA058241-25

• 

Product Description

Protein Description: tRNA methyltransferase 10A
Gene Name: TRMT10A
Alternative Gene Name: MGC27034, RG9MTD2, TRM10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004127: 68%, ENSRNOG00000011025: 61%
Entrez Gene ID: 93587
Uniprot ID: Q8TBZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKE
• Gene Sequence: SSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKE
• Gene ID - Mouse: ENSMUSG00000004127
• Gene ID - Rat: ENSRNOG00000011025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.