Anti TRIP11 pAb (ATL-HPA070684)

Atlas Antibodies

Catalog No: ATL-HPA070684-25

• 

Product Description

Protein Description: thyroid hormone receptor interactor 11
Gene Name: TRIP11
Alternative Gene Name: CEV14, GMAP-210, GMAP210, Trip230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021188: 91%, ENSRNOG00000005292: 92%
Entrez Gene ID: 9321
Uniprot ID: Q15643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
• Gene Sequence: MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
• Gene ID - Mouse: ENSMUSG00000021188
• Gene ID - Rat: ENSRNOG00000005292
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti TRIP11 pAb (ATL-HPA070684) – 1 Found

Ziltener, Pascal; Rebane, Aleksander A; Graham, Morven; Ernst, Andreas M; Rothman, James E. The golgin family exhibits a propensity to form condensates in living cells. Febs Letters. 2020;594(19):3086-3094.