Description
Product Description
Protein Description: thyroid hormone receptor interactor 10
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 96%, ENSRNOG00000055524: 89%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 96%, ENSRNOG00000055524: 89%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA |
Gene Sequence | LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA |
Gene ID - Mouse | ENSMUSG00000019487 |
Gene ID - Rat | ENSRNOG00000055524 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TRIP10 pAb (ATL-HPA073886) | |
Datasheet | Anti TRIP10 pAb (ATL-HPA073886) Datasheet (External Link) |
Vendor Page | Anti TRIP10 pAb (ATL-HPA073886) at Atlas Antibodies |
Documents & Links for Anti TRIP10 pAb (ATL-HPA073886) | |
Datasheet | Anti TRIP10 pAb (ATL-HPA073886) Datasheet (External Link) |
Vendor Page | Anti TRIP10 pAb (ATL-HPA073886) |