Protein Description: thyroid hormone receptor interactor 10
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 86%, ENSRNOG00000055524: 86%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 86%, ENSRNOG00000055524: 86%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE |
| Documents & Links for Anti TRIP10 pAb (ATL-HPA072625) | |
| Datasheet | Anti TRIP10 pAb (ATL-HPA072625) Datasheet (External Link) |
| Vendor Page | Anti TRIP10 pAb (ATL-HPA072625) at Atlas |
| Documents & Links for Anti TRIP10 pAb (ATL-HPA072625) | |
| Datasheet | Anti TRIP10 pAb (ATL-HPA072625) Datasheet (External Link) |
| Vendor Page | Anti TRIP10 pAb (ATL-HPA072625) |