Protein Description: tripartite motif containing 72
Gene Name: TRIM72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042828: 93%, ENSRNOG00000022099: 96%
Entrez Gene ID: 493829
Uniprot ID: Q6ZMU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIM72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042828: 93%, ENSRNOG00000022099: 96%
Entrez Gene ID: 493829
Uniprot ID: Q6ZMU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGE |
| Documents & Links for Anti TRIM72 pAb (ATL-HPA023122) | |
| Datasheet | Anti TRIM72 pAb (ATL-HPA023122) Datasheet (External Link) |
| Vendor Page | Anti TRIM72 pAb (ATL-HPA023122) at Atlas |
| Documents & Links for Anti TRIM72 pAb (ATL-HPA023122) | |
| Datasheet | Anti TRIM72 pAb (ATL-HPA023122) Datasheet (External Link) |
| Vendor Page | Anti TRIM72 pAb (ATL-HPA023122) |
| Citations for Anti TRIM72 pAb (ATL-HPA023122) – 1 Found |
| Lemckert, Frances A; Bournazos, Adam; Eckert, Daniel M; Kenzler, Manuel; Hawkes, Joanne M; Butler, Tanya L; Ceely, Bradley; North, Kathryn N; Winlaw, David S; Egan, Jonathan R; Cooper, Sandra T. Lack of MG53 in human heart precludes utility as a biomarker of myocardial injury or endogenous cardioprotective factor. Cardiovascular Research. 2016;110(2):178-87. PubMed |