Anti TRIM60 pAb (ATL-HPA061496)

Atlas Antibodies

Catalog No: ATL-HPA061496-25

• 

Product Description

Protein Description: tripartite motif containing 60
Gene Name: TRIM60
Alternative Gene Name: FLJ35882, RNF129, RNF33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053490: 56%, ENSRNOG00000055917: 35%
Entrez Gene ID: 166655
Uniprot ID: Q495X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSK
• Gene Sequence: VGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSK
• Gene ID - Mouse: ENSMUSG00000053490
• Gene ID - Rat: ENSRNOG00000055917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.