Anti TRIM39 pAb (ATL-HPA059496)

Atlas Antibodies

Catalog No: ATL-HPA059496-25

• 

Product Description

Protein Description: tripartite motif containing 39
Gene Name: TRIM39
Alternative Gene Name: RNF23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045409: 100%, ENSRNOG00000000785: 100%
Entrez Gene ID: 56658
Uniprot ID: Q9HCM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV
• Gene Sequence: SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV
• Gene ID - Mouse: ENSMUSG00000045409
• Gene ID - Rat: ENSRNOG00000000785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.