Protein Description: tripartite motif containing 31
Gene Name: TRIM31
Alternative Gene Name: C6orf13, HCG1, HCGI, RNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058063: 55%, ENSRNOG00000021518: 49%
Entrez Gene ID: 11074
Uniprot ID: Q9BZY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIM31
Alternative Gene Name: C6orf13, HCG1, HCGI, RNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058063: 55%, ENSRNOG00000021518: 49%
Entrez Gene ID: 11074
Uniprot ID: Q9BZY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLS |
| Documents & Links for Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) | |
| Datasheet | Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) at Atlas |
| Documents & Links for Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) | |
| Datasheet | Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation) |