Anti TRIM29 pAb (ATL-HPA074841)

Atlas Antibodies

Catalog No: ATL-HPA074841-25

• 
• 

Product Description

Protein Description: tripartite motif containing 29
Gene Name: TRIM29
Alternative Gene Name: ATDC, FLJ36085
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032013: 84%, ENSRNOG00000021771: 85%
Entrez Gene ID: 23650
Uniprot ID: Q14134
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEA
• Gene Sequence: TKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEA
• Gene ID - Mouse: ENSMUSG00000032013
• Gene ID - Rat: ENSRNOG00000021771
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.