Anti TRIM24 pAb (ATL-HPA061717 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061717-25

• 
• 

Product Description

Protein Description: tripartite motif containing 24
Gene Name: TRIM24
Alternative Gene Name: hTIF1, RNF82, TIF1, Tif1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029833: 91%, ENSRNOG00000013251: 80%
Entrez Gene ID: 8805
Uniprot ID: O15164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK
• Gene Sequence: NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK
• Gene ID - Mouse: ENSMUSG00000029833
• Gene ID - Rat: ENSRNOG00000013251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.