Anti TRIB1 pAb (ATL-HPA063982)

Catalog No:
ATL-HPA063982-25
$395.00

Description

Product Description

Protein Description: tribbles pseudokinase 1
Gene Name: TRIB1
Alternative Gene Name: C8FW, GIG2, TRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032501: 88%, ENSRNOG00000004100: 90%
Entrez Gene ID: 10221
Uniprot ID: Q96RU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
Gene Sequence VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
Gene ID - Mouse ENSMUSG00000032501
Gene ID - Rat ENSRNOG00000004100
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TRIB1 pAb (ATL-HPA063982)
Datasheet Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link)
Vendor Page Anti TRIB1 pAb (ATL-HPA063982) at Atlas Antibodies

Documents & Links for Anti TRIB1 pAb (ATL-HPA063982)
Datasheet Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link)
Vendor Page Anti TRIB1 pAb (ATL-HPA063982)

Product Description

Protein Description: tribbles pseudokinase 1
Gene Name: TRIB1
Alternative Gene Name: C8FW, GIG2, TRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032501: 88%, ENSRNOG00000004100: 90%
Entrez Gene ID: 10221
Uniprot ID: Q96RU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
Gene Sequence VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP
Gene ID - Mouse ENSMUSG00000032501
Gene ID - Rat ENSRNOG00000004100
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TRIB1 pAb (ATL-HPA063982)
Datasheet Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link)
Vendor Page Anti TRIB1 pAb (ATL-HPA063982) at Atlas Antibodies

Documents & Links for Anti TRIB1 pAb (ATL-HPA063982)
Datasheet Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link)
Vendor Page Anti TRIB1 pAb (ATL-HPA063982)