Protein Description: tribbles pseudokinase 1
Gene Name: TRIB1
Alternative Gene Name: C8FW, GIG2, TRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032501: 88%, ENSRNOG00000004100: 90%
Entrez Gene ID: 10221
Uniprot ID: Q96RU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIB1
Alternative Gene Name: C8FW, GIG2, TRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032501: 88%, ENSRNOG00000004100: 90%
Entrez Gene ID: 10221
Uniprot ID: Q96RU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP |
Documents & Links for Anti TRIB1 pAb (ATL-HPA063982) | |
Datasheet | Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link) |
Vendor Page | Anti TRIB1 pAb (ATL-HPA063982) at Atlas |
Documents & Links for Anti TRIB1 pAb (ATL-HPA063982) | |
Datasheet | Anti TRIB1 pAb (ATL-HPA063982) Datasheet (External Link) |
Vendor Page | Anti TRIB1 pAb (ATL-HPA063982) |