Protein Description: triggering receptor expressed on myeloid cells-like 4
Gene Name: TREML4
Alternative Gene Name: TLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051682: 47%, ENSRNOG00000042360: 47%
Entrez Gene ID: 285852
Uniprot ID: Q6UXN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TREML4
Alternative Gene Name: TLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051682: 47%, ENSRNOG00000042360: 47%
Entrez Gene ID: 285852
Uniprot ID: Q6UXN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL |
Documents & Links for Anti TREML4 pAb (ATL-HPA065044) | |
Datasheet | Anti TREML4 pAb (ATL-HPA065044) Datasheet (External Link) |
Vendor Page | Anti TREML4 pAb (ATL-HPA065044) at Atlas |
Documents & Links for Anti TREML4 pAb (ATL-HPA065044) | |
Datasheet | Anti TREML4 pAb (ATL-HPA065044) Datasheet (External Link) |
Vendor Page | Anti TREML4 pAb (ATL-HPA065044) |