Protein Description: T cell receptor associated transmembrane adaptor 1
Gene Name: TRAT1
Alternative Gene Name: HSPC062, TCRIM, TRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030775: 66%, ENSRNOG00000029564: 64%
Entrez Gene ID: 50852
Uniprot ID: Q6PIZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRAT1
Alternative Gene Name: HSPC062, TCRIM, TRIM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030775: 66%, ENSRNOG00000029564: 64%
Entrez Gene ID: 50852
Uniprot ID: Q6PIZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN |
| Documents & Links for Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) | |
| Datasheet | Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) at Atlas |
| Documents & Links for Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) | |
| Datasheet | Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRAT1 pAb (ATL-HPA072760 w/enhanced validation) |