Anti TRAM2 pAb (ATL-HPA057925)

Atlas Antibodies

Catalog No: ATL-HPA057925-25

• 

Product Description

Protein Description: translocation associated membrane protein 2
Gene Name: TRAM2
Alternative Gene Name: KIAA0057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041779: 100%, ENSRNOG00000013046: 90%
Entrez Gene ID: 9697
Uniprot ID: Q15035
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFLFILPQYNISVPTADSETVHYHYGPKDL
• Gene Sequence: AFLFILPQYNISVPTADSETVHYHYGPKDL
• Gene ID - Mouse: ENSMUSG00000041779
• Gene ID - Rat: ENSRNOG00000013046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.