Protein Description: TNFRSF1A associated via death domain
Gene Name: TRADD
Alternative Gene Name: Hs.89862
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031887: 71%, ENSRNOG00000015179: 76%
Entrez Gene ID: 8717
Uniprot ID: Q15628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRADD
Alternative Gene Name: Hs.89862
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031887: 71%, ENSRNOG00000015179: 76%
Entrez Gene ID: 8717
Uniprot ID: Q15628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ |
| Documents & Links for Anti TRADD pAb (ATL-HPA071341) | |
| Datasheet | Anti TRADD pAb (ATL-HPA071341) Datasheet (External Link) |
| Vendor Page | Anti TRADD pAb (ATL-HPA071341) at Atlas |
| Documents & Links for Anti TRADD pAb (ATL-HPA071341) | |
| Datasheet | Anti TRADD pAb (ATL-HPA071341) Datasheet (External Link) |
| Vendor Page | Anti TRADD pAb (ATL-HPA071341) |