Anti TRADD pAb (ATL-HPA071341)

Atlas Antibodies

Catalog No: ATL-HPA071341-25

• 

Product Description

Protein Description: TNFRSF1A associated via death domain
Gene Name: TRADD
Alternative Gene Name: Hs.89862
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031887: 71%, ENSRNOG00000015179: 76%
Entrez Gene ID: 8717
Uniprot ID: Q15628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ
• Gene Sequence: NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ
• Gene ID - Mouse: ENSMUSG00000031887
• Gene ID - Rat: ENSRNOG00000015179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.