Description
Product Description
Protein Description: tyrosylprotein sulfotransferase 1
Gene Name: TPST1
Alternative Gene Name: TANGO13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034118: 97%, ENSRNOG00000000900: 95%
Entrez Gene ID: 8460
Uniprot ID: O60507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TPST1
Alternative Gene Name: TANGO13A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034118: 97%, ENSRNOG00000000900: 95%
Entrez Gene ID: 8460
Uniprot ID: O60507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE |
| Gene Sequence | PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE |
| Gene ID - Mouse | ENSMUSG00000034118 |
| Gene ID - Rat | ENSRNOG00000000900 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TPST1 pAb (ATL-HPA061837) | |
| Datasheet | Anti TPST1 pAb (ATL-HPA061837) Datasheet (External Link) |
| Vendor Page | Anti TPST1 pAb (ATL-HPA061837) at Atlas Antibodies |
| Documents & Links for Anti TPST1 pAb (ATL-HPA061837) | |
| Datasheet | Anti TPST1 pAb (ATL-HPA061837) Datasheet (External Link) |
| Vendor Page | Anti TPST1 pAb (ATL-HPA061837) |