Description
Product Description
Protein Description: thiopurine S-methyltransferase
Gene Name: TPMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021376: 83%, ENSRNOG00000016468: 86%
Entrez Gene ID: 7172
Uniprot ID: P51580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TPMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021376: 83%, ENSRNOG00000016468: 86%
Entrez Gene ID: 7172
Uniprot ID: P51580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRG |
Gene Sequence | GHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRG |
Gene ID - Mouse | ENSMUSG00000021376 |
Gene ID - Rat | ENSRNOG00000016468 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TPMT pAb (ATL-HPA062364) | |
Datasheet | Anti TPMT pAb (ATL-HPA062364) Datasheet (External Link) |
Vendor Page | Anti TPMT pAb (ATL-HPA062364) at Atlas Antibodies |
Documents & Links for Anti TPMT pAb (ATL-HPA062364) | |
Datasheet | Anti TPMT pAb (ATL-HPA062364) Datasheet (External Link) |
Vendor Page | Anti TPMT pAb (ATL-HPA062364) |